- Recombinant Escherichia coli Phage shock protein G (pspG)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1197335
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 9,023 Da
- E Coli or Yeast
- 29221
- yjbO, ECK4042, JW5716
- Phage shock protein G (pspG)
Sequence
MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWVIKAIKAPKVPKYQRYDRWRY